Page 6 - VLQJWKLVPDQXDO
2 | HP Jornada 520 Series User ’ s Guide :KDW VLQWKHER[ Your HP Jornada package includes the following items: • HP Jornada Pocket PC, with carrying pouch and stylus • ac adapter • serial cable for connection to a desktop PC • HP Jornada Quick Start Guide—a graphic guide to setting up your HP Jornada...
Page 9 - Contacts. Keep track of your friends and colleagues.; Pocket; Microsoft
Chapter 1 | Welcome | 5 0LFURVRIW:LQGRZVIRU3RFNHW3&VRIWZDUH Calendar. Keep track of your appointments and create meeting requests. Contacts. Keep track of your friends and colleagues. Inbox. Send and receive e-mail messages. Notes. Create handwritten or typed notes, drawings, and recordings. Poc...
Page 11 - :KHUHWRILQGLQIRUPDWLRQ
Chapter 1 | Welcome | 7 • Microsoft Money for Pocket PC. Record expenses, balance your checkbook, and track your investments. You can also update Microsoft Money accounts on your desktop PC with information from your HP Jornada. (Microsoft Money for Pocket PC can synchronize only with the US English...
Page 16 - Connect to ac power. Assemble the ac adapter, and connect it to
12 | HP Jornada 520 Series User ’ s Guide Use the stylus to tap the HP Jornada screen to avoid scratches or damage to the screen. To clean the screen, use a small amount of commercial glass cleaner sprayed on a soft cloth. Avoid spraying the screen directly. Be sure to turn off your HP Jornada befor...
Page 17 - Reset your HP Jornada. Press the red Reset button on the back of
Chapter 2 | Getting started | 13 2. Reset your HP Jornada. Press the red Reset button on the back of your Pocket PC. 3. Follow the Welcome Wizard. The first time you start your HP Jornada, the Hewlett-Packard Welcome screen appears. Then, after a few moments, the Welcome Wizard begins. The Welcome W...
Page 19 - HFRUGEXWWRQ
Chapter 2 | Getting started | 15 5HFRUGEXWWRQ • Press and release the Record button to turn on your HP Jornada. • Press and hold the Record button to turn on your HP Jornada and begin recording. If the speaker is not muted, a beep indicates that recording has started. • Release the Record button to ...
Page 20 - $OLJQLQJWKHWRXFKVFUHHQ
16 | HP Jornada 520 Series User ’ s Guide 2Q2IIEXWWRQ • Press the On/Off button to turn your HP Jornada on or off. • If the display has been turned off, press the On/Off button to turn on the display. • Press and hold the On/Off button to open the Align Screen application and recalibrate the stylus ...
Page 21 - ZLWFKLQJSURJUDPV
Chapter 2 | Getting started | 17 7RGD\VFUHHQ When you turn on your HP Jornada for the first time each day (or after 4 hours of inactivity), you will see the Today screen. You can also display it by tapping Today on the Start menu. The Today screen displays all the important information about your da...
Page 22 - Tap in the Navigation bar to display the Start menu.; Start menu, tap the name of the program you want to switch; DYLJDWLRQEDU
18 | HP Jornada 520 Series User ’ s Guide HP home menu displays two pages of buttons and icons that represent the programs and documents on your Pocket PC. To display the second page, press the HP home hot key a second time, or tap the HP home menu icon in the lower-right corner of the HP home menu ...
Page 23 - WDWXVLFRQV; Icon
Chapter 2 | Getting started | 19 &RPPDQGEDU Use the Command bar at the bottom of the screen to perform tasks in programs. The Command bar includes the menus and buttons for the active program, status icons, and the Input panel button. To create a new item in the current program, tap New. To see ...
Page 24 - RSXSPHQXV
20 | HP Jornada 520 Series User ’ s Guide 3RSXSPHQXV Use pop-up menus to choose an action for the selected item. For example, you can use the pop-up menu in the Contact list to quickly delete a contact, make a copy of a contact, or send an e-mail message to a contact. The actions on the pop-up menus...
Page 27 - :ULWLQJRUGUDZLQJRQWKHVFUHHQ
Chapter 2 | Getting started | 23 Because certain letters use similar stylus strokes, it may take some practice to achieve the writing style for the Character Recognizer. For a table of stylus motions and the corresponding letters, see Appendix A, “Character recognition.” For a demonstration of prope...
Page 29 - HFRUGLQJYRLFHQRWHV
Chapter 2 | Getting started | 25 5HFRUGLQJYRLFHQRWHV In any program where you can write or draw on the screen, you can also quickly capture thoughts, reminders, and phone numbers by recording a voice note. In Calendar, Tasks, and Contacts, you can include a recording on the Notes tab. In the Notes p...
Page 30 - Options tab in the Input control panel, select a voice
26 | HP Jornada 520 Series User ’ s Guide ;NLX[MRWPOX[VJ]\ Your HP Jornada supports several formats for voice notes. The formats vary in both the quality of the recording and the size of the sound file. When selecting a recording format, you should consider the quality you need as well as how much s...
Page 31 - Find box, type the text you want to locate.
Chapter 2 | Getting started | 27 =X\NWMJ[NLX[MRWP]XJWX]QN[LXVY^]N[ 1. In the Notes application or in File Explorer, locate the recording you want to send. 2. Tap and hold the name of the recording to display the pop-up menu. 3. On the pop-up menu, tap either Send via E-mail or Send via Infrared. 4. ...
Page 35 - Copying Files dialog box.
Chapter 3 | Connecting to your desktop PC | 31 Optional components • audio card/speakers for sound • modem and/or Ethernet LAN connection for remote synchronization • Microsoft Internet Explorer 4.0 or higher for Mobile Channels or Mobile Favorites support. (Internet Explorer 5.0 is included on the ...
Page 40 - (VWDEOLVKLQJDSDUWQHUVKLS; New Partnership dialog box appears on your desktop PC
36 | HP Jornada 520 Series User ’ s Guide For complete instructions on connecting to your desktop PC by infrared, refer to ActiveSync help on your desktop PC. (VWDEOLVKLQJDSDUWQHUVKLS When you install Microsoft ActiveSync, you are prompted to connect your HP Jornada and create a partnership. A partn...
Page 42 - In the ActiveSync window on your desktop PC, click Options on the; Rules tab, choose one of the options under Conflict
38 | HP Jornada 520 Series User ’ s Guide Control when synchronization occurs by selecting a synchronization mode. For example, you can synchronize continually while your HP Jornada is connected, or only when you choose the Synchronize command. Select which information types are synchronized and con...
Page 43 - Allow network (Ethernet) and Remote Access Service
Chapter 3 | Connecting to your desktop PC | 39 8WbX^[MN\T]XY9, Before you can synchronize remotely, the desktop PC or network server must be configured to allow your HP Jornada to connect. If the desktop PC uses Windows NT or Windows 2000, you must install and configure Remote Access Services. If it...
Page 44 - To turn off automatic conversion, clear the Convert files when; %DFNLQJXSDQGUHVWRULQJGDWD
40 | HP Jornada 520 Series User ’ s Guide You cannot open documents or start programs stored on your HP Jornada by double-clicking their icons in the Mobile Device window on your desktop PC. Double-clicking an icon displays the properties for that file. 7UDQVIHUULQJILOHVEHWZHHQ\RXU+3-RUQDGD DQG\RXUG...
Page 45 - Full Backup (to back up all information every time) or
Chapter 3 | Connecting to your desktop PC | 41 %DFNLQJXSGDWDZLWK$FWLYH6\QF When you back up your HP Jornada using Microsoft ActiveSync, the backup file contains all the files, databases, PIM information, and RAM-based programs on your Pocket PC. The backup file is stored on your desktop PC. If you h...
Page 46 - Backup tab, tap Back up all data or Back up PIM; HVWRULQJGDWD; Restore Now. Do not use your device until the restore process
42 | HP Jornada 520 Series User ’ s Guide 4. Tap the System tab, and then tap HP backup. 5. On the Backup tab, tap Back up all data or Back up PIM databases. 6. In the Name box, type a name for the backup file, and select a storage location from the drop-down list. 7. Tap OK to start the backup. The...
Page 47 - HVWRULQJGDWDZLWK+3EDFNXS; Restore tab, tap Restore all data or Restore PIM
Chapter 3 | Connecting to your desktop PC | 43 ;N\]X[RWPRWL[NVNW]JUKJLT^Y\ If you have made incremental backups, you must restore each backup file individually, starting with the original (full) backup and progressing in sequence from the oldest to the most recent. To select the backup file you want...
Page 49 - RUWRDQHWZRUN; sending and receiving e-mail messages with your HP Jornada
| 45 _ &RQQHFWLQJWRWKH,QWHUQHW RUWRDQHWZRUN In addition to connecting your HP Jornada to your desktop PC partner, you may want to connect to remote computers so you can access e-mail, browse the Internet, or retrieve files from a corporate network (LAN), whether you are at home or on the road. T...
Page 51 - &RQQHFWLQJZLWKDQLQIUDUHGPRGHP
Chapter 4 | Connecting to the Internet | 47 Type I CompactFlash card slot &RQQHFWLQJZLWKDQLQIUDUHGPRGHP You can also use the infrared port on your HP Jornada to connect to the Internet or a remote computer via an IrDA-compatible infrared modem. When you create a new dial-up connection, select Ge...
Page 53 - Next, and then enter the telephone number you dial to connect
Chapter 4 | Connecting to the Internet | 49 Before you can use a modem to connect to an ISP or to dial in to a specific desktop PC, you must create a connection for that service on your HP Jornada. If you use an NIC to connect to a corporate network, you must configure your network connection. Your ...
Page 54 - Start menu, tap Programs, and then tap the Connections
50 | HP Jornada 520 Series User ’ s Guide 4. If your ISP or account administrator provided specific settings, such as IP addresses or DNS addresses, enter this information on the appropriate tab, and then tap OK. 5. On the Identification tab, enter your user name, password, and the domain (if requir...
Page 55 - Connections tab, select a connection from the Type list.
Chapter 4 | Connecting to the Internet | 51 The Pocket Internet Explorer home page =XK[X`\N]QN@NK 1. On the Start menu, tap Internet Explorer. 2. Connect your HP Jornada to a modem or network. (See “Connecting your HP Jornada” earlier in this chapter.) 3. On the Tools menu, tap Options, and then tap...
Page 56 - AvantGo Channels link.
52 | HP Jornada 520 Series User ’ s Guide You can have Pocket Internet Explorer automatically connect to the Internet when you attempt to access a page that is not stored on your HP Jornada. On the Tools menu, tap Options, and then tap the Connections tab. Select a connection, and the select the Acc...
Page 57 - RELOHIDYRULWHV; In Internet Explorer 5 on your desktop PC, click Tools and then; schedule from the Update list.
Chapter 4 | Connecting to the Internet | 53 6XKRUNLQJWWNU\ Mobile channels are sites you subscribe to on your desktop PC. They are stored in the Channels subfolder in the Mobile Favorites folder of your Microsoft Internet Explorer folder and are downloaded to your HP Jornada during synchronization. ...
Page 58 - OK. Internet Explorer downloads the latest version of the Web
54 | HP Jornada 520 Series User ’ s Guide 4. Click OK. Internet Explorer downloads the latest version of the Web page to your desktop PC. 5. If you want to download the pages that are linked to the mobile favorite you just created, in Internet Explorer on the desktop PC, right-click the mobile favor...
Page 59 - HQGLQJDQGUHFHLYLQJHPDLO
Chapter 4 | Connecting to the Internet | 55 Mobile favorites ,XW\N[_RWPVNVX[b Mobile favorites can use a lot of storage memory on your HP Jornada. Follow these tips to minimize the amount of memory used: • Turn off pictures and sounds or stop some mobile favorites from being downloaded to your HP Jo...
Page 60 - HQGLQJDQGUHFHLYLQJPHVVDJHVYL D\RXUGHVNWRS3&; In ActiveSync on your desktop PC, click Options on the Tools menu,
56 | HP Jornada 520 Series User ’ s Guide 6HQGLQJDQGUHFHLYLQJPHVVDJHVYL D\RXUGHVNWRS3& You can send and receive messages on your HP Jornada via the e-mail service on your desktop PC by synchronizing your Inbox. When you enable Inbox synchronization in ActiveSync options, messages are transferred...
Page 63 - To box, enter an e-mail address or select a name from the
Chapter 4 | Connecting to the Internet | 59 • To delete a message, tap . If your messages are still linked to messages on your e-mail server or desktop PC, they will be stored in the Deleted (local) folder. If your messages were downloaded directly from an e-mail server, they will be deleted from bo...
Page 64 - Send when you have finished the message.
60 | HP Jornada 520 Series User ’ s Guide 3. Compose your message. 4. To attach a file, tap the attachment icon. When you send a file as an attachment, be sure the message recipient can read the type of file you are sending. If the recipient does not have a Windows-powered Pocket PC, be sure you sav...
Page 66 - DQDJLQJSRZHU; Start menu, tap HP settings. The remaining power is
62 | HP Jornada 520 Series User ’ s Guide 0DQDJLQJSRZHU Because the data and files you save on your HP Jornada are stored in RAM, maintaining a continuous power supply to the HP Jornada at all times is extremely important. If your HP Jornada runs out of power, all information you have entered is los...
Page 68 - Open the Memory control panel, and then tap the Running; KH6HWWLQJVWDE
64 | HP Jornada 520 Series User ’ s Guide =X^\N]QN6NVX[bLXW][XUYJWNU]X\]XYY[XP[JV\ 1. Open the Memory control panel, and then tap the Running Programs tab. 2. Select a program in the list, and then tap Stop. =X^\N19]J\T\`R]LQN[]X\]XYY[XP[JV\ 1. In the Today screen, tap the HP task switcher icon. 2. ...
Page 69 - KH3UHIHUHQFHVWDE
Chapter 5 | Configuring your HP Jornada | 65 HP settings To change the speaker volume settings, you can quickly switch to the Sounds & Reminders control panel by tapping the Speaker button. Save your preferred settings to any of the four profiles. Select the profile you want to change, and then ...
Page 70 - HWWLQJDSDVVZRUG; Primary tab, enter a four-digit password by tapping the; Enable password protection check box.
66 | HP Jornada 520 Series User ’ s Guide To prevent inadvertently turning on your Pocket PC, you can disable the Record button. On the Preferences tab, select the Disable record button check box. You can also set your Pocket PC to turn on when you press one of the HP hot keys. On the Preferences ta...
Page 71 - $GGLQJRZQHULQIRUPDWLRQ
Chapter 5 | Configuring your HP Jornada | 67 =XL[NJ]NJWMNWJKUNJ[NVRWMN[YJ\\`X[M 1. On the Start menu, tap Settings, and then on the Personal tab, tap the HP security icon. 2. On the Reminder tab, use the Input panel to enter a question in the Question box. 3. In the Answer box, enter the answer to y...
Page 72 - Start menu, tap Settings, and then tap the Owner Information; &RQILJXULQJKDUGZDUHEXWWRQV; KH%XWWRQVFRQWUROSDQHO; Program Buttons tab, select a button from the list.
68 | HP Jornada 520 Series User ’ s Guide =XJMMX[LQJWPNX`WN[RWOX[VJ]RXW 1. On the Start menu, tap Settings, and then tap the Owner Information icon. 2. On the Identification tab, enter, your name, address, and/or other information. 3. On the Notes tab, type any other information you want displayed (...
Page 73 - System tab, and then tap the HP game buttons icon.
Chapter 5 | Configuring your HP Jornada | 69 +3JDPHEXWWRQV The HP game buttons application makes it easier to enjoy your favorite games on your HP Jornada. Use HP game buttons to assign game actions to the hardware buttons of your Pocket PC. =X\]J[]19PJVNK^]]XW\ 1. On the Start menu, tap Settings. 2...
Page 74 - Delete—Tap Delete to clear the current button assignment.
70 | HP Jornada 520 Series User ’ s Guide &RQILJXULQJPHQXV You can customize the menus on your device to ensure you have easy access to programs or documents. +3KRPHPHQX Use the HP home menu application to quickly launch your favorite programs or open frequently used documents. You can modify ea...
Page 75 - WDUWPHQX; Start Menu tab, select the check box for the program you; HZPHQX
Chapter 5 | Configuring your HP Jornada | 71 The HP home menu screen 6WDUWPHQX You can also add or remove programs from the Start menu to make it easier to access the programs you use most. =XJMMJY[XP[JV]X]QN<]J[]VNW^ 1. On the Start menu, tap Settings, and then tap Menus. 2. On the Start Menu ta...
Page 76 - New Menu tab, select the Turn on New button menu check; $GGLQJRUUHPRYLQJSURJUDPV
72 | HP Jornada 520 Series User ’ s Guide =XJMMJMXL^VNW]]X]QNVNW^ 1. On the Start menu, tap Settings, and then tap Menus. 2. On the New Menu tab, select the Turn on New button menu check box, and then select the document types you want to appear on the menu. $GGLQJRUUHPRYLQJSURJUDPV ,QVWDOOLQJSURJUD...
Page 77 - Tools menu in the ActiveSync window, click Add/Remove; HPRYLQJSURJUDPV
Chapter 5 | Configuring your HP Jornada | 73 If the program does not have an associated installer or setup program, drag the program file (typically an *.exe file type) to the HP Jornada icon in the ActiveSync window. If the No Converter Selected dialog box appears, tap OK to copy the file without c...
Page 79 - LFURVRIW3RFNHW2XWORRN
| 75 _ 0LFURVRIW3RFNHW2XWORRN Microsoft Pocket Outlook includes Calendar, Contacts, Tasks, Inbox, and Notes. You can use these programs individually or together. For example, e-mail addresses stored in Contacts can be used to address e-mail messages in Inbox. Using ActiveSync, you can synchronize in...
Page 80 - &DOHQGDUVFKHGXOLQJDSSRLQWPHQWVDQGPHHWLQJV
76 | HP Jornada 520 Series User ’ s Guide &DOHQGDUVFKHGXOLQJDSSRLQWPHQWVDQGPHHWLQJV Use Calendar to schedule appointments, including meetings and other events. You can check your appointments in one of several views (Agenda, Day, Week, Month, and Year) and easily switch views by using the View m...
Page 81 - &UHDWLQJPHHWLQJUHTXHVWV; &RQWDFWVWUDFNLQJIULHQGVDQGFROOHDJXHV
Chapter 6 | Microsoft Pocket Outlook | 77 3. Using the Input panel, enter a description and a location for the appointment. 4. If needed, tap the date and time to change them. 5. Enter other desired information. (You may need to hide the Input panel to see all available fields.) 6. To add notes, tap...
Page 83 - DVNVNHHSLQJDWRGROLVW
Chapter 6 | Microsoft Pocket Outlook | 79 7DVNVNHHSLQJDWRGROLVW Use Tasks to keep track of what you have to do. In the Task list, overdue tasks are displayed in red. When you tap a task in the Task list, a summary screen of the information you entered is displayed. The Task list To change the way in...
Page 84 - To assign the task to a category, tap Categories, and then select a; RWHVFDSWXULQJWKRXJKWVDQGLGHDV
80 | HP Jornada 520 Series User ’ s Guide 4. To assign the task to a category, tap Categories, and then select a category from the list. (In the Task list, you can display tasks by category.) 5. To add notes, tap the Notes tab. You can enter text, draw, or create a recording. For more information on...
Page 85 - ([FKDQJLQJDSSRLQWPHQWVFRQWDFWVWDVNVDQGQRWHV
Chapter 6 | Microsoft Pocket Outlook | 81 =XL[NJ]NJWX]N 1. Tap New. 2. Create your note by writing, drawing, typing, and/or recording. For more information about using the Input panel, writing and drawing on the screen, and creating recordings, see “Entering information” in chapter 2. ([FKDQJLQJDSSR...
Page 86 - $ERXWWKHGDWDEHLQJWUDQVIHUUHG
82 | HP Jornada 520 Series User ’ s Guide =X[NLNR_N926RWOX[VJ]RXWXWbX^[193X[WJMJO[XVJW2[-* NZ^RYYNM9-*MN_RLN 1. Set the PDA device to beam selected item(s). 2. Align the infrared port on your HP Jornada with the infrared port on the sending device. 3. Select Recv(non-Windows) on the Tools menu of a ...
Page 88 - Start menu, tap Programs, and then tap the Pocket Word
84 | HP Jornada 520 Series User ’ s Guide 0LFURVRIW3RFNHW:RUG Microsoft Pocket Word works with Microsoft Word on your desktop PC to give you easy access to copies of your documents. You can create new documents on your HP Jornada, or you can copy documents from your desktop PC to your HP Jornada. Sy...
Page 89 - LSVIRUZRUNLQJLQ3RFNHW:RUG; Start menu, tap Programs, and then tap the Pocket Excel
Chapter 7 | Companion programs | 85 • Drawing mode. In drawing mode, use your stylus to draw on the screen. Gridlines appear as a guide. When you lift your stylus off the screen after the first stroke, you will see a drawing box indicating the boundaries of the drawing. Every subsequent stroke withi...
Page 90 - Start menu, tap Programs, and then tap the Windows Media
86 | HP Jornada 520 Series User ’ s Guide You can open only one workbook at a time; when you open a second workbook, you will be asked to save the first. You can save a workbook you create or edit in a variety of formats, including Pocket Excel (.pxl) and Excel (.xls). 7LSVIRUZRUNLQJLQ3RFNHW([FHO • ...
Page 92 - To specify the location of the song file, click Recorder on the; VLQJWKH3OD\OLVW0DQDJHU
88 | HP Jornada 520 Series User ’ s Guide =XLXYbJ\XWPO[XVJWJ^MRX,- 1. Install MusicMatch Jukebox from the HP Jornada CD-ROM onto your desktop PC. For more information, refer to the HP Jornada CD-ROM. 2. On your desktop PC, start the Jukebox program. 3. Insert an audio CD into the CD-ROM drive on you...
Page 93 - LFURVRIW5HDGHU
Chapter 7 | Companion programs | 89 :RUNLQJZLWKDXGLRILOHVRQD&RPSDFW)ODVK&DUG Because songs and audio files can use a lot of storage memory, you might want to store them on a Type I CompactFlash card. When you store songs and audio files on a Type I CompactFlash card, the files must be stored...
Page 99 - URXEOHVKRRWLQJ
| 95 _ 7URXEOHVKRRWLQJ If you encounter difficulty while using your HP Jornada Pocket PC, this chapter will help you find answers. If you need information about troubleshooting ActiveSync, click Microsoft ActiveSync Help on the Help menu in ActiveSync. The information in this chapter will help you •...
Page 101 - HVWRULQJIDFWRU\GHIDXOWV
Chapter 9 | Troubleshooting | 97 The Reset button 5HVWRULQJIDFWRU\GHIDXOWV In some cases, such as when your HP Jornada does not respond after being reset or when you forget your password, you may need to restore your HP Jornada to the factory default settings. This erases all data you have entered, ...
Page 102 - Problem
98 | HP Jornada 520 Series User ’ s Guide =X[N\]X[N]QNOJL]X[bMNOJ^U]\ 1. Disconnect your HP Jornada from ac power and disconnect it from your desktop PC. 2. Use the tip of the stylus to press and hold the Reset button on the back of your HP Jornada. 3. While holding the Reset button, press the On/Of...
Page 105 - HPRWHFRQQHFWLRQV; $EOHWRGLDORXWEXWXQDEOHWRPDNHSURSHUFRQQHFWLRQ
Chapter 9 | Troubleshooting | 101 Problem Diagnosis/Remedy Cannot reset the factory default settings because there is no backup battery. Refer to “Resetting your HP Jornada” in this chapter. Note that all data in device memory will be erased. Unable to locate files in CompactFlash memory in applicat...
Page 106 - QDEOHWRXVHLQIUDUHGWUDQVIHUEHWZHHQ:LQGRZV SRZHUHG; HWZRUNFRQQHFWLRQSUREOHPV
102 | HP Jornada 520 Series User ’ s Guide 8QDEOHWRXVHLQIUDUHGWUDQVIHUEHWZHHQ:LQGRZV SRZHUHG GHYLFHV If you are unable to use infrared to transfer information between Windows-powered devices, try the following: • Transfer only one file, or no more than 25 contact cards, at a time. • Position the inf...
Page 107 - &DEOHDQGFUDGOHFRQQHFWLRQSUREOHPV
Chapter 9 | Troubleshooting | 103 • You may need to change the device name if you are trying to connect to a network and cannot because another device with the same name is already connected. To change the device name, on the Start menu, tap Settings. On the System tab, tap About, and then the Devic...
Page 108 - FUHHQLVGDUN
104 | HP Jornada 520 Series User ’ s Guide 6FUHHQLVGDUN Prolonged exposure to direct sunlight may cause your device screen to temporarily darken. This is normal for LCD screens and is not permanent. 'LVSOD\LVGLIILFXOWWRVHHLQVXQOLJKWRULQGDUNURRPV Use HP settings to adjust contrast and brightness for ...
Page 109 - XSSRUWDQGVHUYLFH; HUYLFH
| 105 _ 6XSSRUWDQGVHUYLFH :HEVLWH You can obtain product information as well as tips and hints on how to get more from the HP Jornada product at our Worldwide Web site. This computer service is provided free of charge; you pay only for telephone charges and Internet service fees. To connect to this ...
Page 110 - Telephone
106 | HP Jornada 520 Series User ’ s Guide 3. Have your product ready to use. The support personnel may ask you to run tests and other operations. 4. Organize your question or problem. The more detailed information you can provide, the quicker the support personnel can help you. &RQWDFWLQJ+HZOHW...
Page 115 - VRIWZDUHSURGXFWOLPLWHGZDUUDQW\
Warranty | 111 +3VRIWZDUHSURGXFWOLFHQVHDJUHHPHQWDQG+3 VRIWZDUHSURGXFWOLPLWHGZDUUDQW\ This HP product contains preinstalled software programs. Please read the HP Software Product License Agreement before proceeding. Important: Carefully read this License Agreement and the Limited Warranty statement b...
Page 127 - UDQVIHUULQJGDWDIURPDSDOPVL]HRUKDQGKHOG3&
| 123 $SSHQGL[% 0LJUDWLQJGDWDIURP RWKHUGHYLFHV 7UDQVIHUULQJGDWDIURPDSDOPVL]HRUKDQGKHOG3& If you are currently using a Windows-powered palm-size or handheld PC, you can transfer data to your HP Jornada Pocket PC. If you have offline folders in Inbox on your palm-size or handheld PC that contain e...
Page 128 - Copy or move selected messages to your desktop; LJUDWLQJGDWDIURP3DOPGHYLFHV
124 | HP Jornada 520 Series User ’ s Guide =X][JW\ON[XOOURWNOXUMN[\ 1. Connect your palm-size or handheld PC to your desktop PC, and then click Windows CE Inbox Transfer on the Microsoft Outlook Tools menu. 2. Select Copy or move selected messages to your desktop computer, and then click the Browse ...
Page 129 - LJUDWLQJIURPROGHU3DOP RUJDQL]HUV
Appendix B | Migrating data | 125 0LJUDWLQJIURPROGHU3DOP RUJDQL]HUV If you would like to use PocketMirror to synchronize your PalmPilot or Pilot organizer with Microsoft Outlook, you will need to purchase the commercial version of the software from Chapura, the maker of PocketMirror. Check with Chap...
